Technical Specifications

Specification	Details
Product Name	FOXO4-DRI
Strength	10 mg
Molecular Formula	C₂₂₈H₃₈₈N₈₆O₆₄
Molecular Weight	~5,358.06 g/mol
CAS Number	2460055-10-9
Sequence	D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Sequence Length	46 amino acids
Purity	≥98%
Form	Lyophilized Peptide
Classification	D-Retro-Inverso Peptide
Primary Research Target	FOXO4-p53 Protein-Protein Interaction
Intended Use	Laboratory Research Only

---

Product Overview

FOXO4-DRI is a synthetic D-retro-inverso peptide derived from a region of the FOXO4 protein involved in its interaction with p53.

It has been investigated as a research tool for studying cellular senescence, FOXO4-p53 signaling, and mechanisms associated with the survival and elimination of senescent cells. The D-retro-inverso design is intended to provide greater resistance to enzymatic degradation compared with conventional L-amino-acid peptides.

FOXO4-DRI has attracted considerable interest in experimental research involving cellular aging, senescence biology, apoptosis, and protein-protein interactions.

---

Mechanism of Action

Preclinical research has investigated FOXO4-DRI in relation to several biological mechanisms, including:

FOXO4-p53 Interaction

FOXO4-DRI has been studied for its ability to interfere with the interaction between FOXO4 and p53, a protein-protein interaction associated with the survival of senescent cells.

Cellular Senescence Research

Experimental models have investigated FOXO4-DRI as a tool for studying the biology of senescent cells and pathways involved in their persistence.

Apoptosis Research

Research has examined the relationship between disruption of FOXO4-p53 signaling and downstream apoptotic pathways in cellular models.

D-Retro-Inverso Design

The peptide uses a D-retro-inverso configuration designed to improve resistance to enzymatic degradation while retaining molecular recognition characteristics relevant to its research target.

Protein-Protein Interaction Research

FOXO4-DRI is used experimentally to investigate how disruption of specific protein interactions can influence cellular signaling and survival.

---

Research Applications

FOXO4-DRI is commonly investigated in laboratory research involving:

• Cellular senescence research
• FOXO4-p53 interaction studies
• Protein-protein interaction research
• Apoptosis and cell-survival studies
• Molecular aging research
• Senescence-associated signaling
• Experimental longevity research
• Cellular stress research
• Tissue aging models
• Peptide pharmacology research

---

Handling & Storage

• Store the lyophilized peptide according to the manufacturer’s recommended storage conditions.
• Protect from excessive heat, moisture, and direct sunlight.
• Keep the product sealed in its original packaging until required for laboratory research.
• Follow the lot-specific Certificate of Analysis for applicable storage and handling requirements.
• Minimize unnecessary exposure to temperature fluctuations.
• If reconstituted for laboratory research, follow an appropriate validated laboratory protocol.

---

Product Features

✓ Research Grade Quality

✓ 10mg Lyophilized Peptide

✓ ≥98% Purity

✓ Synthetic D-Retro-Inverso Peptide

✓ 46-Amino-Acid Sequence

✓ Carefully Packaged

✓ Laboratory Research Use Only

---

Important Notice

This product is intended exclusively for laboratory research purposes.

It is not intended for human or veterinary use, administration, injection, consumption, diagnosis, treatment, cure, or prevention of any disease.

FOXO4-DRI is an experimental research compound. Its safety, efficacy, pharmacokinetics, and potential therapeutic applications have not been established for human use.

By purchasing this product, the purchaser acknowledges that it will be handled only by qualified professionals in appropriate laboratory environments and used in accordance with applicable laws, regulations, and institutional protocols.

---

Frequently Asked Questions

What is FOXO4-DRI?

FOXO4-DRI is a synthetic D-retro-inverso peptide developed as a research tool for investigating the FOXO4-p53 protein-protein interaction and cellular senescence.

What does FOXO4-DRI target?

Research has primarily investigated FOXO4-DRI in relation to the FOXO4-p53 protein-protein interaction.

What form does FOXO4-DRI 10mg come in?

The product is supplied as a 10mg lyophilized (freeze-dried) peptide for laboratory research.

What is the molecular weight of FOXO4-DRI?

The commonly reported molecular weight is approximately 5,358.06 g/mol.

What is the purity of FOXO4-DRI?

This product is specified at a minimum purity of ≥98%, subject to the applicable batch Certificate of Analysis.

What is FOXO4-DRI researched for?

Research has investigated FOXO4-DRI in areas including cellular senescence, FOXO4-p53 signaling, apoptosis, protein-protein interactions, and experimental aging research.

Is FOXO4-DRI intended for human use?

No. This product is supplied strictly for laboratory research purposes and is not intended for human or veterinary use.

How should FOXO4-DRI be stored?

The lyophilized peptide should be stored according to the manufacturer’s recommended conditions and protected from heat, moisture, and direct sunlight. Always refer to the applicable Certificate of Analysis for batch-specific requirements.