Technical Specifications

Specification	Details
Product Name	Sermorelin
Common Name	Sermorelin Acetate
Chemical Classification	Synthetic Peptide
Molecular Formula	C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight	~3357.96 g/mol
Sequence	Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
Sequence Code	YDAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Sequence Length	29 amino-acid residues
Purity	≥98%
Form	Lyophilized Peptide
Classification	Growth Hormone-Releasing Hormone Analog
Intended Use	Laboratory Research Only

---

Product Overview

Sermorelin is a synthetic peptide corresponding to the N-terminal 29-amino-acid region of human growth hormone-releasing hormone (GHRH).

It has been investigated extensively as a research model for studying GHRH receptor signaling, growth hormone secretion pathways, pituitary-cell activity, and endocrine signaling.

Its defined peptide sequence makes Sermorelin useful for laboratory investigations involving peptide-receptor interactions and the physiological mechanisms associated with GHRH signaling.

---

Mechanism of Action

Research has investigated Sermorelin in relation to several biological mechanisms:

GHRH Receptor Signaling

Sermorelin interacts with the growth hormone-releasing hormone receptor (GHRHR), providing a model for investigating GHRH-mediated cellular signaling.

Growth Hormone Signaling

Experimental research has examined Sermorelin in relation to pathways involved in the regulation of growth hormone (GH) secretion from pituitary cells.

Pituitary Research

Sermorelin is used in experimental systems studying signaling within somatotroph cells, the pituitary cells responsible for growth hormone production.

cAMP Signaling

GHRH receptor activation is associated with intracellular signaling pathways involving cyclic AMP (cAMP), making Sermorelin useful for investigating endocrine signal transduction.

Peptide-Receptor Interactions

Its defined structure provides a model for studying ligand-receptor binding, peptide activity, and structure-function relationships.

---

Research Applications

Sermorelin may be investigated in laboratory settings involving:

• GHRH receptor research
• Growth hormone signaling
• Pituitary-cell research
• Endocrine signaling studies
• cAMP pathway research
• Peptide-receptor interaction studies
• Growth hormone regulation research
• Structure-activity relationship studies
• Synthetic peptide research
• Neuroendocrine research

---

Handling & Storage

• Store the lyophilized peptide according to the manufacturer’s recommended conditions.
• Protect from excessive heat, moisture, and direct sunlight.
• Keep the product sealed in its original packaging until required for laboratory research.
• Store at approximately −20°C when consistent with supplier specifications.
• Follow the applicable batch Certificate of Analysis for exact storage requirements.
• Minimize unnecessary temperature fluctuations.
• Avoid repeated freeze-thaw cycles where applicable.
• Protect the material from prolonged exposure to moisture and light.

---

Product Features

✓ Research Grade Quality

✓ ≥98% Purity

✓ 29-Amino-Acid Peptide

✓ GHRH 1–29 Analog

✓ Growth Hormone-Releasing Hormone Research Compound

✓ Lyophilized for Stability

✓ Carefully Packaged

✓ Laboratory Research Use Only

---

Important Notice

This product is intended exclusively for laboratory research purposes.

It is not intended for human or veterinary use, administration, injection, consumption, diagnosis, treatment, cure, or prevention of any disease.

Sermorelin is associated with an established pharmaceutical research and clinical history. This research-grade material should not be represented as an approved pharmaceutical product or as a substitute for any prescribed medication.

The exact purity, molecular characterization, salt form, counterion, and analytical specifications should be verified against the applicable batch Certificate of Analysis (CoA).

By purchasing this product, the purchaser acknowledges that it will be handled only by qualified professionals in appropriate laboratory environments and used in accordance with applicable laws, regulations, and institutional protocols.

---

Frequently Asked Questions

What is Sermorelin?

Sermorelin is a synthetic peptide corresponding to the N-terminal 29-amino-acid portion of human GHRH and is used as a research model for studying GHRH signaling.

What is the sequence of Sermorelin?

The commonly reported sequence is:

YDAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂

How many amino acids does Sermorelin contain?

Sermorelin contains 29 amino-acid residues.

What is the molecular weight of Sermorelin?

Sermorelin has a molecular weight of approximately 3357.96 g/mol, with the exact value depending on the molecular form and counterion.

What is Sermorelin researched for?

Sermorelin is investigated in research involving GHRH receptor signaling, growth hormone pathways, pituitary-cell biology, endocrine signaling, cAMP pathways, and peptide-receptor interactions.

Is Sermorelin a peptide?

Yes. Sermorelin is a synthetic 29-amino-acid peptide derived from the N-terminal region of human GHRH.

What form does Sermorelin come in?

Research-grade Sermorelin is commonly supplied as a lyophilized (freeze-dried) peptide, often in an acetate form.

What is the purity of Sermorelin?

This product is specified at a minimum purity of ≥98%, subject to the applicable batch Certificate of Analysis.

Is Sermorelin intended for human use?

No. This research-grade product is supplied strictly for laboratory research purposes and is not intended for human or veterinary use.

How should Sermorelin be stored?

The lyophilized peptide should be protected from heat, moisture, and direct sunlight and stored according to the manufacturer’s recommended conditions. Always refer to the batch-specific Certificate of Analysis for exact storage requirements.