Technical Specifications

Specification	Details
Product Name	FOXO4-DRI
Molecular Formula	C₂₂₈H₃₈₈N₈₆O₆₄
Molecular Weight	~5,358.06 g/mol
CAS Number	2460055-10-9
Sequence	D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Sequence Length	46 amino acids
Purity	≥98%
Form	Lyophilized Peptide
Classification	D-Retro-Inverso Peptide
Primary Research Target	FOXO4-p53 Protein-Protein Interaction

---

Product Overview

FOXO4-DRI is a synthetic D-retro-inverso peptide derived from a FOXO4 sequence involved in interaction with the tumor suppressor protein p53.

The peptide was developed as a research tool for investigating the FOXO4-p53 protein-protein interaction and cellular senescence. Its D-retro-inverso configuration is designed to provide increased resistance to enzymatic degradation compared with conventional L-amino-acid peptides.

FOXO4-DRI has become an important experimental compound in research focused on cellular senescence, protein-protein interactions, and mechanisms associated with the accumulation of senescent cells.

---

Mechanism of Action

Preclinical research has investigated FOXO4-DRI in relation to several biological mechanisms, including:

FOXO4-p53 Interaction

FOXO4-DRI has been studied for its ability to interfere with the interaction between FOXO4 and p53, a protein-protein interaction associated with cellular senescence.

Cellular Senescence Research

Research has examined FOXO4-DRI as a tool for studying pathways involved in the persistence and behavior of senescent cells.

p53 Signaling Research

Because FOXO4-DRI interacts with the FOXO4-p53 pathway, experimental studies have investigated its effects on cellular signaling associated with p53 activity.

D-Retro-Inverso Stability

The peptide incorporates D-amino acids in a retro-inverso configuration, a design intended to improve resistance to enzymatic degradation and facilitate experimental investigation of peptide-protein interactions.

Senescence-Related Research

Laboratory studies have investigated FOXO4-DRI in cellular models of senescence and related biological processes.

---

Research Applications

FOXO4-DRI is commonly investigated in laboratory research involving:

• Cellular senescence research
• FOXO4-p53 interaction studies
• Protein-protein interaction research
• p53 signaling studies
• Senescent cell biology
• Molecular aging research
• Cell survival and apoptosis research
• Experimental longevity research
• Peptide-protein interaction studies

---

Handling & Storage

• Store the lyophilized peptide according to the manufacturer’s recommended conditions.
• Protect from heat, moisture, and direct sunlight.
• Maintain the product in its original sealed packaging until required for laboratory use.
• Follow the lot-specific Certificate of Analysis for storage and handling requirements.
• Avoid unnecessary exposure to moisture and repeated temperature fluctuations.
• If reconstituted for laboratory research, follow validated laboratory procedures for the selected solvent and storage conditions.

---

Product Features

✓ Research Grade Quality

✓ ≥98% Purity

✓ Synthetic D-Retro-Inverso Peptide

✓ 46-Amino-Acid Sequence

✓ Lyophilized for Stability

✓ Carefully Packaged

✓ Laboratory Research Use Only

---

Important Notice

This product is intended exclusively for laboratory research purposes.

It is not intended for human or veterinary use, administration, injection, consumption, diagnosis, treatment, cure, or prevention of any disease.

FOXO4-DRI remains an experimental research compound, and its biological effects, safety profile, pharmacokinetics, and clinical applications have not been established for human use.

By purchasing this product, the purchaser acknowledges that it will be handled only by qualified professionals in appropriate laboratory environments and used in accordance with applicable laws, regulations, and institutional protocols.

---

Frequently Asked Questions

What is FOXO4-DRI?

FOXO4-DRI is a synthetic D-retro-inverso peptide developed as a research tool for investigating the FOXO4-p53 protein-protein interaction and cellular senescence.

What does FOXO4-DRI target?

Research has primarily investigated FOXO4-DRI in relation to the FOXO4-p53 protein-protein interaction.

What form does FOXO4-DRI come in?

FOXO4-DRI is commonly supplied as a lyophilized synthetic peptide for laboratory research.

What is the molecular weight of FOXO4-DRI?

The commonly reported molecular weight is approximately 5,358.06 g/mol.

What is the purity of FOXO4-DRI?

This product is specified at a minimum purity of ≥98%, subject to the applicable batch Certificate of Analysis.

Is FOXO4-DRI intended for human use?

No. This product is supplied strictly for laboratory research purposes and is not intended for human or veterinary use.

How should FOXO4-DRI be stored?

The lyophilized peptide should be stored according to the manufacturer’s recommended conditions and protected from heat, moisture, and direct sunlight. Specific storage requirements should be confirmed using the product’s Certificate of Analysis.